PDB entry 5tzc

View 5tzc on RCSB PDB site
Description: Crystal Structure of human PDE2a in complex with (5S)-1-[(3-bromo-4-fluorophenyl)carbonyl]-3,3-difluoro-5-{5-methyl-[1,2,4]triazolo[1,5-a]pyrimidin-7-yl}piperidine
Class: Hydrolase/Hydrolase Inhibitor
Keywords: phosphodiesterase, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2016-11-21, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00408 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5tzca1, d5tzca2
  • Chain 'B':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00408 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5tzcb1, d5tzcb2
  • Chain 'C':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00408 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5tzcc1, d5tzcc2
  • Chain 'D':
    Compound: cGMP-dependent 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tzcd_
  • Heterogens: 7OJ, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tzcA (A:)
    samddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tzcA (A:)
    samddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldflde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tzcB (B:)
    samddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tzcB (B:)
    samddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldflde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tzcC (C:)
    samddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tzcC (C:)
    mddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcp
    tlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchd
    ldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrm
    ldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwk
    ttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdl
    fpkaaelyervasnrehwtkvshkftirglpsnnsldfld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tzcD (D:)
    samddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tzcD (D:)
    ytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlar
    fclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhr
    gtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlm
    rdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrk
    iaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpka
    aelyervasnrehwtkvshkftirglpsnnsldfld