PDB entry 5tyh

View 5tyh on RCSB PDB site
Description: PglD from Campylobacter jejuni NCTC 11168 in complex with 5-(2-furanyl)-1H-pyrazole-3-carboxylic acid
Class: transferase/transferase inhibitor
Keywords: Acetyltransferase Bacterial N-glycan biosynthesis Inhibitor Fragment-based discovery, TRANSFERASE, transferase-transferase inhibitor complex
Deposited on 2016-11-20, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylbacillosamine N-acetyltransferase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) [TaxId:192222]
    Gene: pglD, Cj1123c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tyha_
  • Heterogens: 7O4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tyhA (A:)
    gsamartekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaign
    neirkkiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvil
    ntssviehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatl
    vknqdekgvfvgvpakrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tyhA (A:)
    artekiyiyghglvcedvaknmgykecifldfestlpkydffiaignneirkkiyqkise
    ngfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssviehecvig
    efshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqdekgvfvgv
    pakrm