PDB entry 5ty5

View 5ty5 on RCSB PDB site
Description: Neutron structure from microgravity-grown crystals of Inorganic Pyrophosphatase from Thermococcus theoreducens
Class: hydrolase
Keywords: Neutron, hydrolase, thermophile, microgravity
Deposited on 2016-11-18, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: NEUT
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Thermococcus thioreducens [TaxId:277988]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ty5a_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Thermococcus thioreducens [TaxId:277988]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ty5b_
  • Chain 'C':
    Compound: inorganic pyrophosphatase
    Species: Thermococcus thioreducens [TaxId:277988]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ty5c_
  • Chain 'D':
    Compound: inorganic pyrophosphatase
    Species: Thermococcus thioreducens [TaxId:277988]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ty5d_
  • Chain 'E':
    Compound: inorganic pyrophosphatase
    Species: Thermococcus thioreducens [TaxId:277988]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ty5e_
  • Chain 'F':
    Compound: inorganic pyrophosphatase
    Species: Thermococcus thioreducens [TaxId:277988]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ty5f_
  • Heterogens: DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ty5A (A:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ty5A (A:)
    npfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiipq
    twyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwkd
    isdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ty5B (B:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ty5B (B:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ty5C (C:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ty5C (C:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ty5D (D:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ty5D (D:)
    npfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiipq
    twyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwkd
    isdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ty5E (E:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ty5E (E:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ty5F (F:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ty5F (F:)
    npfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiipq
    twyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwkd
    isdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekf