PDB entry 5twg

View 5twg on RCSB PDB site
Description: human MOB1A bound to human MST1 phosphorylated T353 peptide
Class: signaling protein
Keywords: complex, SIGNALING PROTEIN
Deposited on 2016-11-13, released 2017-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MOB kinase activator 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: MOB1A, C2orf6, MOB4B, MOBK1B, MOBKL1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5twga1
  • Chain 'E':
    Compound: T353 peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TWG (Start-14)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5twgA (A:)
    msflfssrssktfkpkknipegshqyellkhaeatlgsgnlrqavmlpegedlnewiavn
    tvdffnqinmlygtitefcteascpvmsagpryeyhwadgtnikkpikcsapkyidylmt
    wvqdqlddetlfpskigvpfpknfmsvaktilkrlfrvyahiyhqhfdsvmqlqeeahln
    tsfkhfiffvqefnlidrrelaplqelieklgskdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5twgA (A:)
    pkknshqyellkhaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitef
    cteascpvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigv
    pfpknfmsvaktilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidr
    relaplqeliekl
    

  • Chain 'E':
    No sequence available.