PDB entry 5tvr

View 5tvr on RCSB PDB site
Description: JMJD2A in complex with Ni(II) and alpha-Ketoglutarate
Class: oxidoreductase
Keywords: oxidoreductase demethylase monooxygenase epigenetics, OXIDOREDUCTASE
Deposited on 2016-11-09, released 2017-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tvra_
  • Chain 'B':
    Compound: lysine-specific demethylase 4a
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tvrb_
  • Heterogens: NI, AKG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tvrA (A:)
    masesetlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyd
    diddlvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerk
    ywknltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgm
    wktsfawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrh
    kmtlisplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieyg
    kqavlcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaeflkesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvrA (A:)
    etlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddl
    vipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknl
    tfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsf
    awhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtli
    splmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavl
    cscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tvrB (B:)
    masesetlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyd
    diddlvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerk
    ywknltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgm
    wktsfawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrh
    kmtlisplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieyg
    kqavlcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaeflkesel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvrB (B:)
    tlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlv
    ipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknlt
    fnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfa
    whtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlis
    plmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlc
    scrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaae