PDB entry 5tvq

View 5tvq on RCSB PDB site
Description: Mouse Tdp2 catalytic domain bound to SUMO2
Class: hydrolase
Keywords: hydrolase/DNA, dna repair, endonuclease/exonuclease/phosphatase (EEP) domain, hydrolase-dna complex, HYDROLASE
Deposited on 2016-11-09, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-DNA phosphodiesterase 2
    Species: Mus musculus [TaxId:10090]
    Gene: Tdp2, Ttrap
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 2
    Species: Mus musculus [TaxId:10090]
    Gene: SUMO2, SMT3B, SMT3H2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tvqb_
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tvqB (B:)
    snvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpi
    netdtpaqlemededtidvfqqqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tvqB (B:)
    nndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtp
    aqlemededtidvfq