PDB entry 5tv3

View 5tv3 on RCSB PDB site
Description: Crystal structure of the complex of Helicobacter pylori alpha-carbonic anhydrase with (E)-5-(((4-(tert-butyl)phenyl)sulfonyl)imino)-4-methyl-4,5-dihydro-1,3,4-thiadiazole-2-sulfonamide
Class: LYASE/LYASE inhibitor
Keywords: alpha-carbonic anhydrase, Helicobacter pylori, lyase, zinc-metalloenzyme, LYASE-LYASE inhibitor complex
Deposited on 2016-11-07, released 2017-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tv3a_
  • Chain 'B':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tv3b_
  • Chain 'C':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tv3c_
  • Chain 'D':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tv3d_
  • Chain 'E':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tv3e_
  • Chain 'F':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tv3f_
  • Chain 'G':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tv3g_
  • Chain 'H':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tv3h_
  • Heterogens: ZN, 7L3, GOL, CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tv3A (A:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tv3A (A:)
    kwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavf
    fthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllv
    laigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvaw
    fvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tv3B (B:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tv3B (B:)
    kwdyknkengphrwdklhkdfevcksgksqspiniehyyhtdlqfkyaaskpkavffthh
    tlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvlaig
    feegkenpnldpilegqnfkevaldaflpksinyyhfngsltappctegvawfvieeple
    vsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tv3C (C:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tv3C (C:)
    wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavff
    thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
    aigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawf
    vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tv3D (D:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tv3D (D:)
    wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqddlqfkyaaskpkavffth
    htlkasfeptnhinyrghdyvldnvhfhapmeflinktrplsahfvhkdakgrllvlaig
    fgkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawfvieep
    levsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tv3E (E:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tv3E (E:)
    kwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavf
    fthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllv
    laigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvaw
    fvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5tv3F (F:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tv3F (F:)
    wdyknengphrwdklhkdfevcksgksqspiniehyyhtqadlqfkyaaskpkavffthh
    tlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvlaig
    feegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawfvie
    eplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5tv3G (G:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tv3G (G:)
    ntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdlqfkyaaskpkavff
    thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
    aigfeegkenpnldpilegkqnfkevaldaflpksinyyhfngsltappctegvawfvie
    eplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5tv3H (H:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tv3H (H:)
    wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavff
    thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
    aigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawf
    vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr