PDB entry 5tuz

View 5tuz on RCSB PDB site
Description: Structure of human GLP SET-domain (EHMT1) in complex with inhibitor MS0124
Class: Transferase/Transferase Inhibitor
Keywords: Methyl Transferase, Transferase-Transferase Inhibitor complex
Deposited on 2016-11-07, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase EHMT1
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT1, EUHMTASE1, GLP, KIAA1876, KMT1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tuza_
  • Chain 'B':
    Compound: Histone-lysine N-methyltransferase EHMT1
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT1, EUHMTASE1, GLP, KIAA1876, KMT1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tuzb_
  • Heterogens: SAM, ZN, 7L6, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tuzA (A:)
    verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci
    ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr
    arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldnkdgevy
    cidarfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdyger
    fwdikgklfscrcgspkcrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuzA (A:)
    verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci
    ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr
    arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldngevyci
    darfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerfw
    dikgklfscrcgspkcrhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tuzB (B:)
    verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci
    ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr
    arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldnkdgevy
    cidarfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdyger
    fwdikgklfscrcgspkcrhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuzB (B:)
    verivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvci
    ddcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglr
    arlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldevycida
    rfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerfwdi
    kgklfscrcgspkcrhs