PDB entry 5tuy

View 5tuy on RCSB PDB site
Description: Structure of human G9a SET-domain (EHMT2) in complex with inhibitor MS0124
Class: transferase/transferase inhibitor
Keywords: Methyl-TRANSFERASE INHIBITOR complex, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-11-07, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase EHMT2
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT2, BAT8, C6orf30, G9A, KMT1C, NG36
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tuya_
  • Chain 'B':
    Compound: Histone-lysine N-methyltransferase EHMT2
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT2, BAT8, C6orf30, G9A, KMT1C, NG36
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96KQ7 (Start-267)
      • conflict (267)
    Domains in SCOPe 2.07: d5tuyb_
  • Heterogens: ZN, SAM, 7L6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tuyA (A:)
    iicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvddc
    sssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikvrl
    qlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgevycid
    aryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwd
    ikskyftcqcgsekckhsaeaialeqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuyA (A:)
    iicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvddc
    sssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikvrl
    qlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgevycid
    aryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwd
    ikskyftcqcgsekckhsaeaialeqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tuyB (B:)
    iicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvddc
    sssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikvrl
    qlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgevycid
    aryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwd
    ikskyftcqcgsekckhsaeaialeqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuyB (B:)
    crdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvddcss
    snclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikvrlql
    yrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldgevycidaryyg
    nisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwdiksky
    ftcqcgsekckhsaeaialeqsk