PDB entry 5tuo

View 5tuo on RCSB PDB site
Description: Crystal structure of the complex of Helicobacter pylori alpha-carbonic anhydrase with 5-amino-1,3,4-thiadiazole-2-sulfonamide inhibitor.
Class: LYASE/LYASE inhibitor
Keywords: lyase, alpha-carbonic anhydrase, Helicobacter pylori, zinc metalloenzyme, 5-amino-1, 3, 4-thiadiazole-2-sulfonamide, LYASE-LYASE inhibitor complex
Deposited on 2016-11-06, released 2017-09-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tuoa_
  • Chain 'B':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tuob_
  • Chain 'C':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tuoc_
  • Chain 'D':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tuod_
  • Chain 'E':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tuoe_
  • Chain 'F':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tuof_
  • Chain 'G':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tuog_
  • Chain 'H':
    Compound: Alpha-carbonic anhydrase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: C694_06140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tuoh_
  • Heterogens: ZN, CL, 1SA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tuoA (A:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuoA (A:)
    tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdlqfkyaaskpkavfft
    hhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvla
    igfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawfv
    ieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tuoB (B:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuoB (B:)
    kwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqddlqfkyaaskpkavfft
    hhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvla
    igfeegkenpnldpilegkevaldaflpksinyyhfngsltappctegvawfvieeplev
    sakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tuoC (C:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuoC (C:)
    kwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavf
    fthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllv
    laigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvaw
    fvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tuoD (D:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuoD (D:)
    wdyknengphrwdklhkdfevcksgksqspiniehyyhtqddlqfkyaaskpkavffthh
    tlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvlaig
    fgkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawfvieep
    levsakqlaeikkknspnqrpvqpdyntviikssaetr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tuoE (E:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuoE (E:)
    ntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpka
    vffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrl
    lvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegv
    awfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5tuoF (F:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuoF (F:)
    wdyengphrwdklhkdfevcksgksqspiniehyyhtqadlqfkyaaskpkavffthhtl
    kasfeptnhinyrghdyvldnvhfhapmeflinnklsahfvhkdakgrllvlaigfenpn
    ldpilegiqkevaldaflpksinyyhfngsltappctegvawfvivsakqlaeikkrmpn
    qrpvqpdyntviikssaet
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5tuoG (G:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuoG (G:)
    tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqddlqfkyaaskpkavff
    thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
    aigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawf
    vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5tuoH (H:)
    gidpftntkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkya
    askpkavffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhk
    dakgrllvlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltap
    pctegvawfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tuoH (H:)
    wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqddlqfkyaaskpkavffth
    htlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvlai
    gfeegkenpnldpilegiqkkvaldaflpksinyyhfngsltappctegvawfvieeple
    vsakqlaeikkrmknspnqrpvqpdyntviikssaetr