PDB entry 5ttr

View 5ttr on RCSB PDB site
Description: leu 55 pro transthyretin crystal structure
Class: transport
Keywords: transthyretin, amyloid, crystal structure, fap, thyroxine, transport
Deposited on 1998-04-30, released 1999-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.199
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (54)
    Domains in SCOPe 2.07: d5ttra_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (54)
    Domains in SCOPe 2.07: d5ttrb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (54)
    Domains in SCOPe 2.07: d5ttrc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (54)
    Domains in SCOPe 2.07: d5ttrd_
  • Chain 'E':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (54)
    Domains in SCOPe 2.07: d5ttre_
  • Chain 'F':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (54)
    Domains in SCOPe 2.07: d5ttrf_
  • Chain 'G':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (54)
    Domains in SCOPe 2.07: d5ttrg_
  • Chain 'H':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (54)
    Domains in SCOPe 2.07: d5ttrh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ttrA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ttrA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ttrB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ttrB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ttrC (C:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ttrC (C:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ttrD (D:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ttrD (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ttrE (E:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ttrE (E:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ttrF (F:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ttrF (F:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ttrG (G:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ttrG (G:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ttrH (H:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ttrH (H:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp