PDB entry 5tto

View 5tto on RCSB PDB site
Description: X-ray crystal structure of PPARgamma in complex with SR1643
Class: transcription
Keywords: Nuclear Receptor, TRANSCRIPTION
Deposited on 2016-11-04, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ttoa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ttob_
  • Heterogens: 7KK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ttoA (A:)
    npesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikf
    khitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhe
    iiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdl
    aifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrq
    ivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ttoA (A:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfe
    vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
    dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
    rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
    kktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ttoB (B:)
    npesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikf
    khitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhe
    iiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdl
    aifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrq
    ivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ttoB (B:)
    esadlralakhlydsyiksfpltkakarailtgkspfviydmnslmmgedkikfkhitev
    airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktetdmslhpllqeiykd