PDB entry 5tt7

View 5tt7 on RCSB PDB site
Description: Discovery of TAK-659, an Orally Available Investigational Inhibitor of Spleen Tyrosine Kinase (SYK)
Class: Transferase/Transferase Inhibitor
Keywords: Inhibitor, kinase, Leukemia, Lymphoma, Transferase-Transferase Inhibitor complex
Deposited on 2016-11-01, released 2016-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-282)
      • expression tag (283-286)
    Domains in SCOPe 2.07: d5tt7a1, d5tt7a2
  • Heterogens: 7KF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tt7A (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tt7A (A:)
    irpkevyldrklltledkelgsgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmq
    qldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyl
    eesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecin
    yykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlm
    nlcwtydvenrpgfaavelrlrnyyydvvnhhhh