PDB entry 5tt2

View 5tt2 on RCSB PDB site
Description: Inactive conformation of engineered human cystathionine gamma lyase (E59N, R119L, E339V) to depleting methionine
Class: lyase
Keywords: engineered protein, methioninase, inactive form, LYASE
Deposited on 2016-10-31, released 2017-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32929
      • engineered mutation (135)
      • engineered mutation (355)
    Domains in SCOPe 2.07: d5tt2c_
  • Chain 'D':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32929
      • engineered mutation (135)
      • engineered mutation (355)
    Domains in SCOPe 2.07: d5tt2d_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tt2C (C:)
    mgghhhhhhglevlfqgpqekdassqgflphfqhfatqaihvgqdpeqwtsravvppisl
    sttfkqgapgqhsgfnysrsgnptrnclekavaaldgakyclafasglaatvtithllka
    gdqiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnpt
    qkvidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmg
    lvsvnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesn
    pwvekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslgg
    feslaelpaimthasvlkndrdvlgisdtlirlsvgledeedlledldqalkaahppsgi
    hs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tt2C (C:)
    gflphfqhfatqaihvgqgnptrnclekavaaldgakyclafasglaatvtithllkagd
    qiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnptqk
    vidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmglv
    svnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesnpw
    vekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslggfe
    slaelpaimtlgisdtlirlsvgledeedlledldqalkaahp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tt2D (D:)
    mgghhhhhhglevlfqgpqekdassqgflphfqhfatqaihvgqdpeqwtsravvppisl
    sttfkqgapgqhsgfnysrsgnptrnclekavaaldgakyclafasglaatvtithllka
    gdqiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnpt
    qkvidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmg
    lvsvnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesn
    pwvekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslgg
    feslaelpaimthasvlkndrdvlgisdtlirlsvgledeedlledldqalkaahppsgi
    hs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tt2D (D:)
    gflphfqhfatqaihvgqgnptrnclekavaaldgakyclafasglaatvtithllkagd
    qiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnptqk
    vidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmglv
    svnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesnpw
    vekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslggfe
    slaelpaimtlgisdtlirlsvgledeedlledldqalkaahp