PDB entry 5tsw

View 5tsw on RCSB PDB site
Description: high resolution crystal structure of a human tnf-alpha mutant
Class: lymphokine
Keywords: lymphokine, low systemic toxicity, mutant
Deposited on 1999-04-22, released 1999-05-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tumor necrosis factor-alpha)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.06: d5tswa_
  • Chain 'B':
    Compound: protein (tumor necrosis factor-alpha)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.06: d5tswb_
  • Chain 'C':
    Compound: protein (tumor necrosis factor-alpha)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.06: d5tswc_
  • Chain 'D':
    Compound: protein (tumor necrosis factor-alpha)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.06: d5tswd_
  • Chain 'E':
    Compound: protein (tumor necrosis factor-alpha)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.06: d5tswe_
  • Chain 'F':
    Compound: protein (tumor necrosis factor-alpha)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.06: d5tswf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tswA (A:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tswA (A:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tswB (B:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tswB (B:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tswC (C:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tswC (C:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tswD (D:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tswD (D:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tswE (E:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tswE (E:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5tswF (F:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tswF (F:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial