PDB entry 5tsu

View 5tsu on RCSB PDB site
Description: Active conformation for Engineered human cystathionine gamma lyase (E59N, R119L, E339V) to depleting methionine
Class: lyase
Keywords: Engineered protein, methioninase, inactive form, LYASE
Deposited on 2016-10-31, released 2017-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32929
      • engineered mutation (75)
      • engineered mutation (135)
      • engineered mutation (355)
    Domains in SCOPe 2.07: d5tsua_
  • Chain 'B':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32929
      • engineered mutation (75)
      • engineered mutation (135)
      • engineered mutation (355)
    Domains in SCOPe 2.07: d5tsub_
  • Chain 'C':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32929
      • engineered mutation (75)
      • engineered mutation (135)
      • engineered mutation (355)
    Domains in SCOPe 2.07: d5tsuc_
  • Chain 'D':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32929
      • engineered mutation (75)
      • engineered mutation (135)
      • engineered mutation (355)
    Domains in SCOPe 2.07: d5tsud_
  • Chain 'E':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32929
      • engineered mutation (75)
      • engineered mutation (135)
      • engineered mutation (355)
    Domains in SCOPe 2.07: d5tsue_
  • Chain 'F':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32929
      • engineered mutation (75)
      • engineered mutation (135)
      • engineered mutation (355)
    Domains in SCOPe 2.07: d5tsuf_
  • Chain 'G':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32929
      • engineered mutation (75)
      • engineered mutation (135)
      • engineered mutation (355)
    Domains in SCOPe 2.07: d5tsug_
  • Chain 'H':
    Compound: Cystathionine gamma-lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: CTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32929
      • engineered mutation (75)
      • engineered mutation (135)
      • engineered mutation (355)
    Domains in SCOPe 2.07: d5tsuh_
  • Heterogens: MET, SO4, LPI, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tsuA (A:)
    mgghhhhhhglevlfqgpqekdassqgflphfqhfatqaihvgqdpeqwtsravvppisl
    sttfkqgapgqhsgfnysrsgnptrnclekavaaldgakyclafasglaatvtithllka
    gdqiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnpt
    qkvidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmg
    lvsvnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesn
    pwvekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslgg
    feslaelpaimthasvlkndrdvlgisdtlirlsvgledeedlledldqalkaahppsgs
    hs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsuA (A:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqggfnysrsgnptrnclekav
    aaldgakyclafasglaatvtithllkagdqiicmddvyggtnlyfrqvasefglkisfv
    dcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfmspyf
    qrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspidcylc
    nrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgctgmvt
    fyikgtlqhaeiflknlklftlavslggfeslaelpaimthasvkndrdvlgisdtlirl
    svgledeedlledldqalkaahpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tsuB (B:)
    mgghhhhhhglevlfqgpqekdassqgflphfqhfatqaihvgqdpeqwtsravvppisl
    sttfkqgapgqhsgfnysrsgnptrnclekavaaldgakyclafasglaatvtithllka
    gdqiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnpt
    qkvidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmg
    lvsvnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesn
    pwvekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslgg
    feslaelpaimthasvlkndrdvlgisdtlirlsvgledeedlledldqalkaahppsgs
    hs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsuB (B:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgsgfnysrsgnptrncleka
    vaaldgakyclafasglaatvtithllkagdqiicmddvyggtnlyfrqvasefglkisf
    vdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfmspy
    fqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspidcyl
    cnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgctgmv
    tfyikgtlqhaeiflknlklftlavslggfeslaelpaimthasvlkndrdvlgisdtli
    rlsvgledeedlledldqalkaahp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tsuC (C:)
    mgghhhhhhglevlfqgpqekdassqgflphfqhfatqaihvgqdpeqwtsravvppisl
    sttfkqgapgqhsgfnysrsgnptrnclekavaaldgakyclafasglaatvtithllka
    gdqiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnpt
    qkvidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmg
    lvsvnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesn
    pwvekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslgg
    feslaelpaimthasvlkndrdvlgisdtlirlsvgledeedlledldqalkaahppsgs
    hs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsuC (C:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgsgfnysrsgnptrncleka
    vaaldgakyclafasglaatvtithllkagdqiicmddvyggtnlyfrqvasefglkisf
    vdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfmspy
    fqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspidcyl
    cnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgctgmv
    tfyikgtlqhaeiflknlklftlavslggfeslaelpaimthasvlkndrdvlgisdtli
    rlsvgledeedlledldqalkaahpp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tsuD (D:)
    mgghhhhhhglevlfqgpqekdassqgflphfqhfatqaihvgqdpeqwtsravvppisl
    sttfkqgapgqhsgfnysrsgnptrnclekavaaldgakyclafasglaatvtithllka
    gdqiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnpt
    qkvidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmg
    lvsvnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesn
    pwvekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslgg
    feslaelpaimthasvlkndrdvlgisdtlirlsvgledeedlledldqalkaahppsgs
    hs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsuD (D:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgsgfnysrsgnptrncl
    ekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnlyfrqvasefglk
    isfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfm
    spyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspid
    cylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgct
    gmvtfyikgtlqhaeiflknlklftlavslggfeslaelpaimthasdrdvlgisdtlir
    lsvgledeedlledldqalkaahp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tsuE (E:)
    mgghhhhhhglevlfqgpqekdassqgflphfqhfatqaihvgqdpeqwtsravvppisl
    sttfkqgapgqhsgfnysrsgnptrnclekavaaldgakyclafasglaatvtithllka
    gdqiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnpt
    qkvidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmg
    lvsvnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesn
    pwvekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslgg
    feslaelpaimthasvlkndrdvlgisdtlirlsvgledeedlledldqalkaahppsgs
    hs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsuE (E:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqggfnysrsgnptrnclekav
    aaldgakyclafasglaatvtithllkagdqiicmddvyggtnlyfrqvasefglkisfv
    dcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfmspyf
    qrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspidcylc
    nrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgctgmvt
    fyikgtlqhaeiflknlklftlavslggfeslaelpaimthasvlkndrdvlgisdtlir
    lsvgledeedlledldqalkaahpp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5tsuF (F:)
    mgghhhhhhglevlfqgpqekdassqgflphfqhfatqaihvgqdpeqwtsravvppisl
    sttfkqgapgqhsgfnysrsgnptrnclekavaaldgakyclafasglaatvtithllka
    gdqiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnpt
    qkvidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmg
    lvsvnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesn
    pwvekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslgg
    feslaelpaimthasvlkndrdvlgisdtlirlsvgledeedlledldqalkaahppsgs
    hs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsuF (F:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgagfnysrsgnptrncleka
    vaaldgakyclafasglaatvtithllkagdqiicmddvyggtnlyfrqvasefglkisf
    vdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfmspy
    fqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspidcyl
    cnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgctgmv
    tfyikgtlqhaeiflknlklftlavslggfeslaelpaimthandrdvlgisdtlirlsv
    gledeedlledldqalkaahp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5tsuG (G:)
    mgghhhhhhglevlfqgpqekdassqgflphfqhfatqaihvgqdpeqwtsravvppisl
    sttfkqgapgqhsgfnysrsgnptrnclekavaaldgakyclafasglaatvtithllka
    gdqiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnpt
    qkvidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmg
    lvsvnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesn
    pwvekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslgg
    feslaelpaimthasvlkndrdvlgisdtlirlsvgledeedlledldqalkaahppsgs
    hs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsuG (G:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgsgfnysrsgnptrncl
    ekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnlyfrqvasefglk
    isfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfm
    spyfqrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspid
    cylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgct
    gmvtfyikgtlqhaeiflknlklftlavslggfeslaelpaimthlkndrdvlgisdtli
    rlsvgledeedlledldqalkaahpp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5tsuH (H:)
    mgghhhhhhglevlfqgpqekdassqgflphfqhfatqaihvgqdpeqwtsravvppisl
    sttfkqgapgqhsgfnysrsgnptrnclekavaaldgakyclafasglaatvtithllka
    gdqiicmddvyggtnlyfrqvasefglkisfvdcskiklleaaitpetklvwietptnpt
    qkvidiegcahivhkhgdiilvvdntfmspyfqrplalgadismysatkymnghsdvvmg
    lvsvnceslhnrlrflqnslgavpspidcylcnrglktlhvrmekhfkngmavaqflesn
    pwvekviypglpshpqhelvkrqctgctgmvtfyikgtlqhaeiflknlklftlavslgg
    feslaelpaimthasvlkndrdvlgisdtlirlsvgledeedlledldqalkaahppsgs
    hs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tsuH (H:)
    gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqsgfnysrsgnptrnclekav
    aaldgakyclafasglaatvtithllkagdqiicmddvyggtnlyfrqvasefglkisfv
    dcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfmspyf
    qrplalgadismysatkymnghsdvvmglvsvnceslhnrlrflqnslgavpspidcylc
    nrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgctgmvt
    fyikgtlqhaeiflknlklftlavslggfeslaelpaimthasvlkndrdvlgisdtlir
    lsvgledeedlledldqalkaahpps