PDB entry 5tss

View 5tss on RCSB PDB site
Description: toxic shock syndrome toxin-1: orthorhombic p222(1) crystal form
Class: toxin
Keywords: toxin, superantigen, signal
Deposited on 1996-12-11, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.148
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tssa1, d5tssa2
  • Chain 'B':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tssb1, d5tssb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tssA (A:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tssB (B:)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein