PDB entry 5trt

View 5trt on RCSB PDB site
Description: Crystal Structure of enoyl-(acyl carrier protein) reductase from Burkholderia pseudomallei 1710b bound to NAD
Class: oxidoreductase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Enoyl [acyl Carrier Protein] Reductase (nadh) Activity Oxidoreductase Activity, OXIDOREDUCTASE
Deposited on 2016-10-27, released 2016-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: fabI, BURPS1710b_2636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5trta_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: fabI, BURPS1710b_2636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5trtb_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: fabI, BURPS1710b_2636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5trtc_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: fabI, BURPS1710b_2636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5trtd_
  • Heterogens: EDO, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5trtA (A:)
    mahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefa
    aefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltren
    friahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvry
    lavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafl
    lsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trtA (A:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggma
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5trtB (B:)
    mahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefa
    aefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltren
    friahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvry
    lavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafl
    lsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trtB (B:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvtaevmhvd
    sgfnavvggma
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5trtC (C:)
    mahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefa
    aefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltren
    friahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvry
    lavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafl
    lsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trtC (C:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvtae
    vmhvdsgfnavvggm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5trtD (D:)
    mahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefa
    aefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltren
    friahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvry
    lavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafl
    lsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trtD (D:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvtaevm
    hvdsgfnavvggma