PDB entry 5trf

View 5trf on RCSB PDB site
Description: MDM2 in complex with SAR405838
Class: ligase/ligase inhibitor
Keywords: P53-BINDING PROTEIN, ONCOPROTEIN, DOUBLE MINUTE 2 PROTEIN, SMALL MOLECULE INHIBITOR, LIGASE-LIGASE INHIBITOR complex
Deposited on 2016-10-26, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trfa_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trfb_
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trfc_
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trfd_
  • Chain 'E':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5trfe_
  • Heterogens: 7HC, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5trfA (A:)
    tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyde
    kqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trfA (A:)
    tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyqh
    ivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5trfB (B:)
    tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyde
    kqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trfB (B:)
    tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyqq
    hivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5trfC (C:)
    tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyde
    kqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trfC (C:)
    dgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydek
    qqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5trfD (D:)
    tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyde
    kqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trfD (D:)
    tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydq
    hivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5trfE (E:)
    tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyde
    kqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5trfE (E:)
    tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyde
    kqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvv