PDB entry 5tr8

View 5tr8 on RCSB PDB site
Description: Crystal structure of vaccine-elicited pan- influenza H1N1 neutralizing murine antibody 441D6.
Class: immune system
Keywords: Nanoparticle, Ferritin, Immune system, Antibody
Deposited on 2016-10-25, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 441D6 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: HC
    Database cross-references and differences (RAF-indexed):
    • PDB 5TR8 (0-113)
    • Uniprot A0A0E4B366 (114-220)
      • conflict (120)
  • Chain 'L':
    Compound: 441D6 Fab Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TR8 (0-108)
    • Uniprot Q7TS98 (109-211)
    Domains in SCOPe 2.07: d5tr8l1, d5tr8l2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tr8L (L:)
    dikmtqspssmyaslgervtftckasqdiyssfswfqqrpgkspktliyranrlvdgvps
    rfsgsgsgqdysltissleyedmgvyfclqheefpptfgggtklelkrtdaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn