PDB entry 5tr7

View 5tr7 on RCSB PDB site
Description: Crystal structure of a putative D-alanyl-D-alanine carboxypeptidase from Vibrio cholerae O1 biovar eltor str. N16961
Class: penicillin-binding protein
Keywords: PBP5, penicil-binding protein, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE, PENICILLIN-BINDING PROTEIN
Deposited on 2016-10-25, released 2016-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Vibrio cholerae [TaxId:243277]
    Gene: VC0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5tr7a_
  • Chain 'B':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Vibrio cholerae [TaxId:243277]
    Gene: VC0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5tr7b_
  • Chain 'C':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: Vibrio cholerae [TaxId:243277]
    Gene: VC0947
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5tr7c_
  • Heterogens: PEG, NO2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tr7A (A:)
    pdapqiaakgyvlmdyhsgkvlaekemdtklspasltkmmtsyvigqevkrgnislnddv
    visknawaknfpdsskmfvevgttvkvsdlnrgiiiqsgndacvamaehvagtedafvdl
    mnawasslgmknshftnshglddpnlystpydlallgqalirdvpeeyaiyseqkftyng
    itqynrngllwdksmnvdgiktghtsgagynlvssategnmrlvavvmgtdnenarkaes
    kkllsygfrffetvaphkagetfvnetiwmgdkdtialgvdkdtyvtlprgqakdltasf
    vlekqlkaplkkgdivgtlyyqlagndiaqypllaledvqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tr7A (A:)
    dapqiaakgyvlmdyhsgkvlaekemdtklspasltkmmtsyvigqevkrgnislnddvv
    isknawaknfpdsskmfvevgttvkvsdlnrgiiiqsgndacvamaehvagtedafvdlm
    nawasslgmknshftnshglddpnlystpydlallgqalirdvpeeyaiyseqkftyngi
    tqynrngllwdksmnvdgiktghtsgagynlvssategnmrlvavvmgtdnenarkaesk
    kllsygfrffe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tr7B (B:)
    pdapqiaakgyvlmdyhsgkvlaekemdtklspasltkmmtsyvigqevkrgnislnddv
    visknawaknfpdsskmfvevgttvkvsdlnrgiiiqsgndacvamaehvagtedafvdl
    mnawasslgmknshftnshglddpnlystpydlallgqalirdvpeeyaiyseqkftyng
    itqynrngllwdksmnvdgiktghtsgagynlvssategnmrlvavvmgtdnenarkaes
    kkllsygfrffetvaphkagetfvnetiwmgdkdtialgvdkdtyvtlprgqakdltasf
    vlekqlkaplkkgdivgtlyyqlagndiaqypllaledvqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tr7B (B:)
    apqiaakgyvlmdyhsgkvlaekemdtklspasltkmmtsyvigqevkrgnislnddvvi
    sknawaknfpdsskmfvevgttvkvsdlnrgiiiqsgndacvamaehvagtedafvdlmn
    awasslgmknshftnshglddpnlystpydlallgqalirdvpeeyaiyseqkftyngit
    qynrngllwdksmnvdgiktghtsgagynlvssategnmrlvavvmgtdnenarkaeskk
    llsygfrff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tr7C (C:)
    pdapqiaakgyvlmdyhsgkvlaekemdtklspasltkmmtsyvigqevkrgnislnddv
    visknawaknfpdsskmfvevgttvkvsdlnrgiiiqsgndacvamaehvagtedafvdl
    mnawasslgmknshftnshglddpnlystpydlallgqalirdvpeeyaiyseqkftyng
    itqynrngllwdksmnvdgiktghtsgagynlvssategnmrlvavvmgtdnenarkaes
    kkllsygfrffetvaphkagetfvnetiwmgdkdtialgvdkdtyvtlprgqakdltasf
    vlekqlkaplkkgdivgtlyyqlagndiaqypllaledvqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tr7C (C:)
    dapqiaakgyvlmdyhsgkvlaekemdtklspasltkmmtsyvigqevkrgnislnddvv
    isknawaknfpdsskmfvevgttvkvsdlnrgiiiqsgndacvamaehvagtedafvdlm
    nawasslgmknshftnshglddpnlystpydlallgqalirdvpeeyaiyseqkftyngi
    tqynrngllwdksmnvdgiktghtsgagynlvssategnmrlvavvmgtdnenarkaesk
    kllsygfrffe