PDB entry 5tqp

View 5tqp on RCSB PDB site
Description: lipoxygenase-1 (soybean) i553g mutant at 300k
Class: oxidoreductase
Keywords: lipoxygenase, hydrogen tunneling, OXIDOREDUCTASE
Deposited on 2016-10-24, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seed linoleate 13S-lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • see remark 999 (159)
      • engineered mutation (552)
    Domains in SCOPe 2.07: d5tqpa1, d5tqpa2
  • Chain 'B':
    Compound: Seed linoleate 13S-lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • see remark 999 (159)
      • engineered mutation (552)
    Domains in SCOPe 2.07: d5tqpb1, d5tqpb2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tqpA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangigettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tqpA (A:)
    hkikgtvvlmpknelevavdnlnaflgrsvslqlisatkadahgkgkvgkdtflegints
    lptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfvcnsw
    vyntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkeydriydydvyn
    dlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlk
    skdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiipl
    pvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksn
    ldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktya
    trtilflredgtlkpvaielslphavsqvvlpakegvestiwllakayvivndscyhqlm
    shwlnthaamepfviathrhlsvlhpiyklltphyrnnmninalarqslinangigettf
    lpskysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadglei
    waaiktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlve
    vcliiiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrt
    itsklptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklv
    rrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tqpB (B:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangigettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tqpB (B:)
    ghkikgtvvlmpknelevnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslp
    tlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfvcnswvy
    ntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkeydriydydvyndl
    gnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlksk
    daleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpv
    ikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnld
    paiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatr
    tilflredgtlkpvaielslphvsqvvlpakegvestiwllakayvivndscyhqlmshw
    lnthaamepfviathrhlsvlhpiyklltphyrnnmninalarqslinangigettflps
    kysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaa
    iktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcl
    iiiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtits
    klptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrn
    ndpslqgnrlgpvqlpytllypsseegltfrgipnsisi