PDB entry 5tqn

View 5tqn on RCSB PDB site
Description: Lipoxygenase-1 (soybean) L546A mutant at 293K
Class: oxidoreductase
Keywords: lipoxygenase, hydrogen tunneling, OXIDOREDUCTASE
Deposited on 2016-10-24, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seed linoleate 13S-lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • see remark 999 (159)
      • engineered mutation (545)
    Domains in SCOPe 2.07: d5tqna1, d5tqna2
  • Chain 'B':
    Compound: Seed linoleate 13S-lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • see remark 999 (159)
      • engineered mutation (545)
    Domains in SCOPe 2.07: d5tqnb1, d5tqnb2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tqnA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqsainangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tqnA (A:)
    hkikgtvvlmpknelevnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslpt
    lgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfvcnswvyn
    tklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkeydriydydvyndlg
    npdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskd
    aleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvi
    kelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldp
    aiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrt
    ilflredgtlkpvaielslphavsqvvlpakegvestiwllakayvivndscyhqlmshw
    lnthaamepfviathrhlsvlhpiyklltphyrnnmninalarqsainangiiettflps
    kysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaa
    iktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcl
    iiiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtits
    klptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrn
    ndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tqnB (B:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqsainangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tqnB (B:)
    hkikgtvvlmpknelevnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslpt
    lgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfvcnswvyn
    tklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkeydriydydvyndlg
    npdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskd
    aleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvi
    kelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldp
    aiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrt
    ilflredgtlkpvaielslphvsqvvlpakegvestiwllakayvivndscyhqlmshwl
    nthaamepfviathrhlsvlhpiyklltphyrnnmninalarqsainangiiettflpsk
    ysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaai
    ktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcli
    iiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsk
    lptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnn
    dpslqgnrlgpvqlpytllypsseegltfrgipnsisi