PDB entry 5tpu

View 5tpu on RCSB PDB site
Description: x-ray structure of the WlaRB TDP-quinovose 3,4-ketoisomerase from campylobacter jejuni
Class: isomerase
Keywords: ketoisomerase, quinovose, deoxy-sugar, ISOMERASE
Deposited on 2016-10-21, released 2017-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS4 (4-End)
      • expression tag (3)
      • engineered mutation (121-123)
    Domains in SCOPe 2.06: d5tpua1, d5tpua2
  • Chain 'B':
    Compound: Putative uncharacterized protein
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS4
      • engineered mutation (121-123)
    Domains in SCOPe 2.06: d5tpub_
  • Chain 'C':
    Compound: Putative uncharacterized protein
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS4
      • engineered mutation (121-123)
    Domains in SCOPe 2.06: d5tpuc_
  • Chain 'D':
    Compound: Putative uncharacterized protein
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS4 (4-End)
      • expression tag (3)
      • engineered mutation (121-123)
    Domains in SCOPe 2.06: d5tpud1, d5tpud2
  • Heterogens: TYD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tpuA (A:)
    ggghmiknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknl
    eqvlimmsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfy
    daaayirnydeflrnindt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tpuA (A:)
    hmiknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknleqv
    limmsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfydaa
    ayirnydeflrni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tpuB (B:)
    ggghmiknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknl
    eqvlimmsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfy
    daaayirnydeflrnindt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tpuB (B:)
    iknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknleqvli
    mmsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfydaaay
    irnydeflrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tpuC (C:)
    ggghmiknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknl
    eqvlimmsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfy
    daaayirnydeflrnindt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tpuC (C:)
    iknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknleqvli
    mmsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfydaaay
    irnydeflrni
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tpuD (D:)
    ggghmiknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknl
    eqvlimmsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfy
    daaayirnydeflrnindt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tpuD (D:)
    hmiknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknleqv
    limmsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfydaa
    ayirnydeflrn