PDB entry 5tpt

View 5tpt on RCSB PDB site
Description: The Crystal Structure of Amyloid Precursor-Like Protein 2 (APLP2) E2 Domain
Class: protein fibril
Keywords: Amyloid Precursor Protein family, Alzheimer's disease, protein fibril
Deposited on 2016-10-21, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: APLP2, APPL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tpta_
  • Chain 'B':
    Compound: Amyloid-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: APLP2, APPL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tptb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tptA (A:)
    dvdvyfetsaddneharfqkakeqleirhrnrmdrvkkeweeaelqaknlpkaerqtliq
    hfqamvkalekeaasekqqlvethlarveamlndrrrmalenylaalqsdpprphrilqa
    lrryvraenkdrlhtirhyqhvlavdpekaaqmksqvmthlhvieerrnqslsllykvpy
    vaqeiqeeidellqeqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tptB (B:)
    dvdvyfetsaddneharfqkakeqleirhrnrmdrvkkeweeaelqaknlpkaerqtliq
    hfqamvkalekeaasekqqlvethlarveamlndrrrmalenylaalqsdpprphrilqa
    lrryvraenkdrlhtirhyqhvlavdpekaaqmksqvmthlhvieerrnqslsllykvpy
    vaqeiqeeidellqeqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tptB (B:)
    harfqkakeqleirhrnrmdrvkkeweeaelqaknlpkaerqtliqhfqamvkalekeaa
    sekqqlvethlarveamlndrrrmalenylaalqsdpprphrilqalrryvraenkdrlh
    tirhyqhvlavdpekaaqmksqvmthlhvieerrnqslsllykvpyvaqeiqeeidellq
    e