PDB entry 5tps

View 5tps on RCSB PDB site
Description: Structure of a Fc heterodimer
Class: immune system
Keywords: antibody, Fc heterodimer, IMMUNE SYSTEM
Deposited on 2016-10-21, released 2017-10-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (138)
      • engineered mutation (150)
      • engineered mutation (193)
    Domains in SCOPe 2.06: d5tpsa1, d5tpsa2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (133)
      • engineered mutation (150)
      • engineered mutation (152)
      • engineered mutation (189)
      • engineered mutation (191)
    Domains in SCOPe 2.06: d5tpsb1, d5tpsb2
  • Heterogens: NAG, MAN, BMA, GAL, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tpsA (A:)
    gsgggdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkf
    nwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiekt
    iskakgqprepqvytlppcrdeltknqvslwclvkgfypsdiavewesngqpennykttp
    pvldsdgsfflysaltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tpsA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
    styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppcrde
    ltknqvslwclvkgfypsdiavewesngqpennykttppvldsdgsfflysaltvdksrw
    qqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tpsB (B:)
    gsgggdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkf
    nwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiekt
    iskakgqprepqvctlppsrdeltknqvslscavkgfypsdiavewesngqpennykttp
    pvldsdgsfklvskltvdksrwqqgnvfscsvmhealhnhytqkslslspgkggshhhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tpsB (B:)
    svflfppkpkdtlmisrtpevtcvvevkfnwyvdgvevhnaktkpreeqynstyrvvsvl
    tvlhqdwlngkeykckvsniektiskakgqprepqvctlppsrdeltknqvslscavkgf
    ypsdiavewesngqpennykttppvldsdgsfklvskltvdksrwqqgnvfscsvmheal
    hnhytqkslsls