PDB entry 5tpq

View 5tpq on RCSB PDB site
Description: E. coli alkaline phosphatase D101A, D153A, R166S, E322A, K328A mutant
Class: hydrolase
Keywords: Alkaline Phosphatase, generalist enzyme, bimetallo motif, catalytic promiscuity, evolution, D101A/D153A/R166S/E322A/K328A, HYDROLASE
Deposited on 2016-10-20, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-441)
      • engineered mutation (93)
      • engineered mutation (145)
      • engineered mutation (158)
      • engineered mutation (314)
      • engineered mutation (320)
      • expression tag (442-445)
    Domains in SCOPe 2.07: d5tpqa1, d5tpqa2
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (Start-441)
      • engineered mutation (93)
      • engineered mutation (145)
      • engineered mutation (158)
      • engineered mutation (314)
      • engineered mutation (320)
      • expression tag (442-444)
    Domains in SCOPe 2.07: d5tpqb1, d5tpqb2
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tpqA (A:)
    enraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaeg
    aggffkgidalpltgqythyalnkktgkpdyvtasaasatawstgvktyngalgvdihek
    dhptilemakaaglatgnvstaelqaatpaalvahvtsskcygpsatsekcpgnalekgg
    kgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvt
    eanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkai
    ellsknekgfflqvagasidaqdhaanpcgqigetvdldeavqralefakkegntlvivt
    adhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaa
    nvvgltdqtdlfytmkaalglkwshp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tpqB (B:)
    enraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaeg
    aggffkgidalpltgqythyalnkktgkpdyvtasaasatawstgvktyngalgvdihek
    dhptilemakaaglatgnvstaelqaatpaalvahvtsskcygpsatsekcpgnalekgg
    kgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvt
    eanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkai
    ellsknekgfflqvagasidaqdhaanpcgqigetvdldeavqralefakkegntlvivt
    adhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaa
    nvvgltdqtdlfytmkaalglkwshp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tpqB (B:)
    nraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaega
    ggffkgidalpltgqythyalnkktgkpdyvtasaasatawstgvktyngalgvdihekd
    hptilemakaaglatgnvstaelqaatpaalvahvtsskcygpsatsekcpgnalekggk
    gsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvte
    anqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkaie
    llsknekgfflqvagasidaqdhaanpcgqigetvdldeavqralefakkegntlvivta
    dhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaan
    vvgltdqtdlfytmkaalglkwsh