PDB entry 5tp0

View 5tp0 on RCSB PDB site
Description: Human mesotrypsin in complex with diminazene
Class: Hydrolase/Hydrolase Inhibitor
Keywords: trypsin, serine-type endopeptidase, serine hydrolase, complex with small molecule drug, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2016-10-19, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Trypsin-3
  Species: Homo sapiens [TaxId:9606]
  Gene: PRSS3, PRSS4, TRY3, TRY4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35030 (0-223)
    • variant (107)
  Domains in SCOPe 2.07: d5tp0a_
• Heterogens: CA, SO4, BRN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5tp0A (A:)
  ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
  neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
  wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdsggp
  vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans