PDB entry 5tp0

View 5tp0 on RCSB PDB site
Description: Human mesotrypsin in complex with diminazene
Class: Hydrolase/Hydrolase Inhibitor
Keywords: trypsin, serine-type endopeptidase, serine hydrolase, complex with small molecule drug, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2016-10-19, released 2017-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
    Domains in SCOPe 2.06: d5tp0a_
  • Heterogens: CA, SO4, BRN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tp0A (A:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdsggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans