PDB entry 5tos

View 5tos on RCSB PDB site
Description: Botrytis-induced kinase 1 (BIK1) from Arabidopsis thaliana
Class: transferase
Keywords: serine/threonine-protein kinase, BIK1, PAMP-triggered immunity, TRANSFERASE
Deposited on 2016-10-18, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase BIK1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BIK1, At2g39660, F12L6.32, F17A14.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tosa_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase BIK1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BIK1, At2g39660, F12L6.32, F17A14.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tosb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tosA (A:)
    mgscfssrvkadifhngkssdlyglslssrkssstvaaaqktegeilsstpvksftfnel
    klatrnfrpdsvigeggfgcvfkgwldestltptkpgtglviavkklnqegfqghrewlt
    einylgqlshpnlvkligycledehrllvyefmqkgslenhlfrrgayfkplpwflrvnv
    aldaakglaflhsdpvkviyrdikasnilldadynaklsdfglardgpmgdlsyvstrvm
    gtygyaapeymssghlnarsdvysfgvllleilsgkraldhnrpakeenlvdwarpylts
    krkvllivdnrldtqylpeeavrmasvavqclsfepksrptmdqvvralqqlqdnlgkps
    qtnpvkdtkklgfktgttkssekrftqkpfgrhlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tosA (A:)
    vksftfnelklatrnfrpcvfkgwldestltptkpgtglviavkklnqegfqghrewlte
    inylgqlshpnlvkligycledehrllvyefmqkgslenhlfrrgayfkplpwflrvnva
    ldaakglaflhsdpvkviyrdikasnilldadynaklsdfglygyaapeymssghlnars
    dvysfgvllleilsgkraldhnrpakeenlvdwarpyltskrkvllivdnrldtqylpee
    avrmasvavqclsfepksrptmdqvvralqqlqdnlgkps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tosB (B:)
    mgscfssrvkadifhngkssdlyglslssrkssstvaaaqktegeilsstpvksftfnel
    klatrnfrpdsvigeggfgcvfkgwldestltptkpgtglviavkklnqegfqghrewlt
    einylgqlshpnlvkligycledehrllvyefmqkgslenhlfrrgayfkplpwflrvnv
    aldaakglaflhsdpvkviyrdikasnilldadynaklsdfglardgpmgdlsyvstrvm
    gtygyaapeymssghlnarsdvysfgvllleilsgkraldhnrpakeenlvdwarpylts
    krkvllivdnrldtqylpeeavrmasvavqclsfepksrptmdqvvralqqlqdnlgkps
    qtnpvkdtkklgfktgttkssekrftqkpfgrhlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tosB (B:)
    vksftfnelklatrnfrpcvfkgwldestltptkpgtglviavkklnqegfqghrewlte
    inylgqlshpnlvkligycledehrllvyefmqkgslenhlfrrgayfkplpwflrvnva
    ldaakglaflhsdpvkviyrdikasnilldadynaklsdfglygyaapeymssghlnars
    dvysfgvllleilsgkraldhnrpakeenlvdwarpyltskrkvllivdnrldtqylpee
    avrmasvavqclsfepksrptmdqvvralqqlqdnlgkps