PDB entry 5toa

View 5toa on RCSB PDB site
Description: Crystal Structure of ER beta bound to Estradiol
Class: transcription
Keywords: Estrogen receptor, estradiol, Helix 12, agonist, TRANSCRIPTION
Deposited on 2016-10-17, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5toaa_
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92731 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5toab_
  • Heterogens: EST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5toaA (A:)
    malspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
    iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    rgdkssitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5toaA (A:)
    alspeqlvltlleaepphvlisrpapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmydssrklahllnavtdalvwviaksgissqqq
    smrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5toaB (B:)
    malspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
    iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    rgdkssitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5toaB (B:)
    malspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmypssrklahllnavtdalvwviaksgissq
    qqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvlr