PDB entry 5to2

View 5to2 on RCSB PDB site
Description: Crystal structure of streptavidin with one wild type subunit and three mutated subunits (N23A/S27D/S45A)
Class: biotin-binding protein
Keywords: Streptavidin, BIOTIN-BINDING PROTEIN
Deposited on 2016-10-16, released 2017-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (0-End)
      • engineered mutation (8)
      • engineered mutation (12)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d5to2a_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (0-End)
      • engineered mutation (8)
      • engineered mutation (12)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d5to2b_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (0-End)
      • engineered mutation (8)
      • engineered mutation (12)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d5to2c_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5to2d_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5to2A (A:)
    agitgtwyaqlgdtfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    psaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5to2A (A:)
    agitgtwyaqlgdtfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5to2B (B:)
    agitgtwyaqlgdtfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    psaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5to2B (B:)
    agitgtwyaqlgdtfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    p
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5to2C (C:)
    agitgtwyaqlgdtfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    psaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5to2C (C:)
    agitgtwyaqlgdtfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    p
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5to2D (D:)
    agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    psaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5to2D (D:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk