PDB entry 5tnc

View 5tnc on RCSB PDB site
Description: refined crystal structure of troponin c from turkey skeletal muscle at 2.0 angstroms resolution
Class: contractile system proteins
Keywords: contractile system proteins
Deposited on 1988-05-27, released 1988-10-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.155
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin-c
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10246 (1-161)
      • conflict (98-99)
      • conflict (132)
    Domains in SCOPe 2.04: d5tnca_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tncA (A:)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkedakgkseeeledcfrifdknadgfidieelge
    ilratgehvteediedlmkdsdknndgridfdeflkmmegvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tncA (A:)
    smtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldai
    ieevdedgsgtidfeeflvmmvrqmkedakgkseeeledcfrifdknadgfidieelgei
    lratgehvteediedlmkdsdknndgridfdeflkmmegvq