PDB entry 5tnc

View 5tnc on RCSB PDB site
Description: refined crystal structure of troponin c from turkey skeletal muscle at 2.0 angstroms resolution
Deposited on 1988-05-27, released 1988-10-09
The last revision prior to the SCOP 1.57 freeze date was dated 1989-01-09, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.155
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d5tnc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tnc_ (-)
    smtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldai
    ieevdedgsgtidfeeflvmmvrqmkedakgkseeeledcfrifdknadgfidieelgei
    lratgehvteediedlmkdsdknndgridfdeflkmmegvq