PDB entry 5tmc

View 5tmc on RCSB PDB site
Description: Re-refinement of Thermus thermopiles DNA-directed RNA polymerase structure
Class: transferase
Keywords: Symmetry Downshifting, Validation of Symmetry, TRANSFERASE
Deposited on 2016-10-12, released 2016-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tmca1, d5tmca2
  • Chain 'B':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tmcb1, d5tmcb2
  • Chain 'C':
    Compound: DNA-directed RNA polymerase subunit beta
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tmcc_
  • Chain 'D':
    Compound: DNA-directed RNA polymerase subunit beta'
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tmcd_
  • Chain 'E':
    Compound: DNA-directed RNA polymerase subunit omega
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72ID6
      • conflict (60)
      • conflict (91)
      • conflict (94)
    Domains in SCOPe 2.07: d5tmce_
  • Chain 'F':
    Compound: RNA polymerase sigma factor SigA
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tmcf1, d5tmcf2, d5tmcf3
  • Chain 'Z':
    Compound: unknown protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 5TMC (0-47)
  • Heterogens: PO4, MG, ZN, G4P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tmcA (A:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tmcA (A:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tmcB (B:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tmcB (B:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapee
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tmcC (C:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5tmcD (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvk
    dgeevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpge
    ilaelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivek
    gqplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegar
    veagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdv
    ladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlk
    yvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweli
    qldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeek
    kqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradi
    eaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvi
    elfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyve
    agqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyve
    vtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieeark
    eaveakerpaarrgvkreqpgkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tmcD (D:)
    kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
    kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
    eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
    geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
    laelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekg
    qplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarv
    eagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvl
    adggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleem
    khpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdln
    dlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplr
    sltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkm
    eekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlv
    egqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakp
    srdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlky
    vfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliq
    ldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekk
    qyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnply
    vmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgg
    adtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradie
    aglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvc
    qkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvie
    lfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyvea
    gqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvev
    tdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfq
    ntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearke
    avea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tmcE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    etwamkelltgrlvfgenlvpedrlqkemeriypgeree
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tmcE (E:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
    twamkelltgrlvfgenlvpedrlqkemeriypge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5tmcF (F:)
    mkkskrknaqaqeaqetevlvqeeaeelpefpegepdpdledpdlaleddlldlpeegeg
    ldleeeeedlpipkistsdpvrqylheigqvplltleeevelarkveegmeaikklseit
    gldpdlirevvrakilgsarvrhipglketldpktveeidqklkslpkehkrylhiareg
    eaarqhlieanlrlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyat
    wwirqainraiadqartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwd
    akrveetlkiaqepvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsk
    lsereamvlklrkglidgrehtleevgaffgvtrerirqienkalrklkyhesrtrklrd
    fld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tmcF (F:)
    pkistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvr
    akilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanl
    rlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraia
    dqartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaq
    epvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklr
    kglidgrehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld
    

  • Chain 'Z':
    No sequence available.