PDB entry 5tm0

View 5tm0 on RCSB PDB site
Description: Solution NMR structures of two alternative conformations of E. coli tryptophan repressor in dynamic equilibrium
Class: transcription
Keywords: Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG, TRANSCRIPTION
Deposited on 2016-10-12, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: trp operon repressor
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: trpR, Z5995, ECs5351
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A882 (0-107)
  Domains in SCOPe 2.07: d5tm0a_
• Chain 'B':
  Compound: trp operon repressor
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: trpR, Z5995, ECs5351
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A882 (0-107)
  Domains in SCOPe 2.07: d5tm0b_
• Chain 'C':
  Compound: trp operon repressor
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: trpR, Z5995, ECs5351
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A882 (0-107)
  Domains in SCOPe 2.07: d5tm0c_
• Chain 'D':
  Compound: trp operon repressor
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: trpR, Z5995, ECs5351
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A882 (0-107)
  Domains in SCOPe 2.07: d5tm0d_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5tm0A (A:)
  maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
  llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5tm0B (B:)
  maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
  llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5tm0C (C:)
  maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
  llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5tm0D (D:)
  maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
  llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd