PDB entry 5tm0
View 5tm0 on RCSB PDB site
Description: Solution NMR structures of two alternative conformations of E. coli tryptophan repressor in dynamic equilibrium
Class: transcription
Keywords: Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG, TRANSCRIPTION
Deposited on
2016-10-12, released
2017-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: trp operon repressor
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: trpR, Z5995, ECs5351
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5tm0a_ - Chain 'B':
Compound: trp operon repressor
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: trpR, Z5995, ECs5351
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5tm0b_ - Chain 'C':
Compound: trp operon repressor
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: trpR, Z5995, ECs5351
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5tm0c_ - Chain 'D':
Compound: trp operon repressor
Species: Escherichia coli O157:H7 [TaxId:83334]
Gene: trpR, Z5995, ECs5351
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5tm0d_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5tm0A (A:)
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5tm0B (B:)
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>5tm0C (C:)
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>5tm0D (D:)
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd