PDB entry 5tkp

View 5tkp on RCSB PDB site
Description: Crystal structure of FBP aldolase from Toxoplasma gondii, equilibrium Schiff base FBP complex
Class: lyase
Keywords: tim barrel, aldolase, glycolysis, lyase, substrate, intermediate, covalent, schiff base
Deposited on 2016-10-07, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: ald-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tkpa_
  • Heterogens: P6F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tkpA (A:)
    msgyglpisqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyr
    dllfstkglgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltdd
    ekatmgldglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicq
    anrlvpivepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsd
    cpkpasheeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsf
    sygralqasclkawkgvpenkakaqqvlmerarangeaqlgkygggaggalaasslfekr
    yvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tkpA (A:)
    sgyglpisqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyrd
    llfstkglgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltdde
    katmgldglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicqa
    nrlvpivepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsdc
    pkpasheeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsfs
    ygralqasclkawkgvpenkakaqqvlmerarangeaqlgkygggayvy