PDB entry 5tkc

View 5tkc on RCSB PDB site
Description: Crystal structure of FBP aldolase from Toxoplasma gondii, ternary complex
Class: lyase
Keywords: tim barrel, aldolase, glycolysis, lyase, substrate, intermediate, enamine, covalent
Deposited on 2016-10-06, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: ald-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tkca_
  • Heterogens: 13P, G3H, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tkcA (A:)
    msgyglpisqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyr
    dllfstkglgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltdd
    ekatmgldglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicq
    anrlvpivepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsd
    cpkpasheeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsf
    sygralqasclkawkgvpenkakaqqvlmerarangeaqlgkygggaggalaasslfekr
    yvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tkcA (A:)
    sgyglpisqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyrd
    llfstkglgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltdde
    katmgldglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicqa
    nrlvpivepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsdc
    pkpasheeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsfs
    ygralqasclkawkgvpenkakaqqvlmerarangeaqlgkygggyvy