PDB entry 5tjf

View 5tjf on RCSB PDB site
Description: The crystal structure of Allophycocyanin from the red algae Gracilaria chilensis
Class: photosynthesis
Keywords: allophycocianin, phycobilisome, phycobiliproteins, FRET, PHOTOSYNTHESIS
Deposited on 2016-10-04, released 2017-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allophycocyanin alpha subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5tjfa_
  • Chain 'B':
    Compound: allophycocyanin beta subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5tjfb_
  • Heterogens: CYC, PEG, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tjfA (A:)
    siitksivnadaearylspgeldriksfvlsgqrrlriaqiltdnrelivkqggqqlfqk
    rpdvvspggnaygeemtatclrdldyylrlvtygivagdvtpieeiglvgvkemynslgt
    pisgvaegvrsmknvacsllagedsaeagfyfdytlgamq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tjfB (B:)
    mqdaitsvinaadvqgrylddnsldklrgyfqtgelrvrasatiaanaatiikdsvakal
    lysditrpggnmyttrryaacirdldyylryatygmlagdpsildervlnglketynslg
    vpigatiqavqamkevtsslvgpdagkemgvyfdyicsgls