PDB entry 5tid

View 5tid on RCSB PDB site
Description: X-ray structure of acyl-CoA thioesterase I, TesA, mutant M141L/Y145K/L146K at pH 5 in complex with octanoic acid
Class: hydrolase
Keywords: Thioesterase, TesA, fatty acid, octanoic acid, HYDROLASE
Deposited on 2016-10-02, released 2017-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA Thioesterase I
    Species: Escherichia coli [TaxId:562]
    Gene: tesA, apeA, pldC, b0494, JW0483
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADA1 (4-End)
      • expression tag (2-3)
      • engineered mutation (143)
      • engineered mutation (147-148)
    Domains in SCOPe 2.07: d5tida1, d5tida2
  • Heterogens: OCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tidA (A:)
    gggmdtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpal
    lkqhqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrry
    neafsaiypklakefdvpllpffleevkkkpqwmqddgihpnrdaqpfiadwmakqlqpl
    vnhds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tidA (A:)
    gmdtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallk
    qhqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrryne
    afsaiypklakefdvpllpffleevkkkpqwmqddgihpnrdaqpfiadwmakqlqpl