PDB entry 5tic

View 5tic on RCSB PDB site
Description: X-ray structure of wild-type E. coli Acyl-CoA thioesterase I at pH 5
Class: hydrolase
Keywords: Thioesterase, TesA, Fatty Acid, HYDROLASE
Deposited on 2016-10-02, released 2017-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA Thioesterase I
    Species: Escherichia coli [TaxId:562]
    Gene: tesA, apeA, pldC, b0494, JW0483
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADA1 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d5tica1, d5tica2
  • Chain 'B':
    Compound: Acyl-CoA Thioesterase I
    Species: Escherichia coli [TaxId:562]
    Gene: tesA, apeA, pldC, b0494, JW0483
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ADA1 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d5ticb1, d5ticb2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ticA (A:)
    gggmdtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpal
    lkqhqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrry
    neafsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqpl
    vnhds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ticA (A:)
    mdtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
    hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
    fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ticB (B:)
    gggmdtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpal
    lkqhqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrry
    neafsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqpl
    vnhds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ticB (B:)
    mdtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
    hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
    fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplv