PDB entry 5tgl

View 5tgl on RCSB PDB site
Description: a model for interfacial activation in lipases from the structure of a fungal lipase-inhibitor complex
Deposited on 1991-10-30, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3 Å
R-factor: 0.185
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d5tgl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tgl_ (-)
    giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
    mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
    tvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvgnpaf
    anyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdletsdc
    snsivpftsvldhlsyfgintglct