PDB entry 5tfd

View 5tfd on RCSB PDB site
Description: Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance regulator (CFTR) with CTP
Class: hydrolase
Keywords: hNBD1, CFTR, ABC transport, ATP, HYDROLASE
Deposited on 2016-09-24, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR, ABCC7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13569
      • engineered mutation (52)
    Domains in SCOPe 2.07: d5tfda_
  • Heterogens: MG, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tfdA (A:)
    sltttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelep
    segkikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekd
    nivlgeggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklman
    ktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfssklmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tfdA (A:)
    tevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepsegk
    ikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdnivl
    geggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktri
    lvtskmehlkkadkililhegssyfygtfselqnl