PDB entry 5tea

View 5tea on RCSB PDB site
Description: Crystal structure of an inorganic pyrophosphatase from Neisseria gonorrhoeae
Class: hydrolase
Keywords: structural genomics, SSGCID, NIAID, gonococci, Seattle Structural Genomics Center for Infectious Disease, HYDROLASE
Deposited on 2016-09-20, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: PPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0G4
      • conflict (53)
      • conflict (165)
    Domains in SCOPe 2.07: d5teaa_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: PPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0G4
      • conflict (53)
      • conflict (165)
    Domains in SCOPe 2.07: d5teab_
  • Chain 'C':
    Compound: inorganic pyrophosphatase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: PPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0G4
      • conflict (53)
      • conflict (165)
    Domains in SCOPe 2.07: d5teac_
  • Chain 'D':
    Compound: inorganic pyrophosphatase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: PPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0G4
      • conflict (53)
      • conflict (165)
    Domains in SCOPe 2.07: d5tead_
  • Chain 'E':
    Compound: inorganic pyrophosphatase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: PPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0G4
      • conflict (53)
      • conflict (165)
    Domains in SCOPe 2.07: d5teae_
  • Chain 'F':
    Compound: inorganic pyrophosphatase
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: PPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0G4
      • conflict (53)
      • conflict (165)
    Domains in SCOPe 2.07: d5teaf_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5teaA (A:)
    mahhhhhhmadfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifa
    kptnygfipqtldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpa
    ddrnngnayktlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesier
    wnkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5teaA (A:)
    fnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifakptnygfipqt
    ldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpaddrnngnaykt
    lsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesierwnkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5teaB (B:)
    mahhhhhhmadfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifa
    kptnygfipqtldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpa
    ddrnngnayktlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesier
    wnkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5teaB (B:)
    dfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifakptnygfipq
    tldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpaddrnngnayk
    tlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesierwnkq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5teaC (C:)
    mahhhhhhmadfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifa
    kptnygfipqtldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpa
    ddrnngnayktlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesier
    wnkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5teaC (C:)
    dfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifakptnygfipq
    tldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpaddrnngnayk
    tlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesierwnkq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5teaD (D:)
    mahhhhhhmadfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifa
    kptnygfipqtldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpa
    ddrnngnayktlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesier
    wnkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5teaD (D:)
    dfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifakptnygfipq
    tldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpaddrnngnayk
    tlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesierwnkq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5teaE (E:)
    mahhhhhhmadfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifa
    kptnygfipqtldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpa
    ddrnngnayktlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesier
    wnkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5teaE (E:)
    dfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifakptnygfipq
    tldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpaddrnngnayk
    tlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesierwnk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5teaF (F:)
    mahhhhhhmadfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifa
    kptnygfipqtldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpa
    ddrnngnayktlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesier
    wnkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5teaF (F:)
    dfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifakptnygfipq
    tldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpaddrnngnayk
    tlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesierwnkq