PDB entry 5te2

View 5te2 on RCSB PDB site
Description: Crystal structure of 7,8-diaminopelargonic acid synthase (BioA) from Mycobacterium tuberculosis, complexed with a mechanism-based inhibitor
Class: Transferase/Transferase inhibitor
Keywords: Inhibitor complex, transaminase, PLP, Transferase, Transferase-inhibitor complex, mechanism-based inhibitor, Transferase-Transferase inhibitor complex
Deposited on 2016-09-20, released 2017-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) [TaxId:233413]
    Gene: bioA, Mb1595
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5te2a_
  • Chain 'B':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) [TaxId:233413]
    Gene: bioA, Mb1595
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5te2b_
  • Heterogens: 7B9, PEG, EDO, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5te2A (A:)
    mgsshhhhhhssglvprgshmaaatggltpeqiiavdgahlwhpyssigreavspvvava
    ahgawltlirdgqpievldamsswwtaihghghpaldqalttqlrvmnhvmfgglthepa
    arlakllvditpagldtvffsdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgd
    tflamsicdphggmhslwtdvlaaqvfapqvprdydpaysaafeaqlaqhagelaavvve
    pvvqgaggmrfhdprylhdlrdicrryevllifdeiatgfgrtgalfaadhagvspdimc
    vgkaltggylslaatlctadvahtisagaagalmhgptfmanplacavsvasvelllgqd
    wrtritelaagltagldtaralpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlr
    pfrnlvyamppyictpaeitqitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5te2A (A:)
    ltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwta
    ihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvs
    vevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvf
    apqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrry
    evllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisa
    gaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtd
    vrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamv
    evarlvgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5te2B (B:)
    mgsshhhhhhssglvprgshmaaatggltpeqiiavdgahlwhpyssigreavspvvava
    ahgawltlirdgqpievldamsswwtaihghghpaldqalttqlrvmnhvmfgglthepa
    arlakllvditpagldtvffsdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgd
    tflamsicdphggmhslwtdvlaaqvfapqvprdydpaysaafeaqlaqhagelaavvve
    pvvqgaggmrfhdprylhdlrdicrryevllifdeiatgfgrtgalfaadhagvspdimc
    vgkaltggylslaatlctadvahtisagaagalmhgptfmanplacavsvasvelllgqd
    wrtritelaagltagldtaralpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlr
    pfrnlvyamppyictpaeitqitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5te2B (B:)
    gltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwt
    aihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsv
    svevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqv
    fapqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrr
    yevllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtis
    agaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavt
    dvrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsam
    vevarlvg