PDB entry 5tcw

View 5tcw on RCSB PDB site
Description: ACC oxidase complex with nickel and acetate
Class: oxidoreductase
Keywords: substrate complex, OXYGENASE, OXIDOREDUCTASE
Deposited on 2016-09-15, released 2017-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate oxidase 1
    Species: PETUNIA HYBRIDA [TaxId:4102]
    Gene: ACO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5tcwa_
  • Heterogens: ACT, NI

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tcwA (A:)
    menfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkc
    meqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakr
    leklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtda
    ggiillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqk
    dgarmslasfynpgsdaviypapalvekeaeenkqvypkfvfddymklyaglkfqakepr
    feamkametdvkmdpiatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tcwA (A:)
    enfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcm
    eqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrl
    eklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdag
    giillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkd
    garmslasfynpgsdaviypapalvqvypkfvfddymklyaglkfqakeprfeamkame