PDB entry 5tco

View 5tco on RCSB PDB site
Description: Human p38 MAP Kinase in Complex with Dibenzosuberone Compound 1
Class: transferase
Keywords: Inhibitor, Dibenzosuberone, Human p38 MAP Kinase, transferase
Deposited on 2016-09-15, released 2017-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tcoa_
  • Heterogens: 79Q, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tcoA (A:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tcoA (A:)
    ptfyrqelnktiwevperyqnlspvgssvcaafdtktglrvavkklsrpfqsiihakrty
    relrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvqf
    liyqilrglkyihsadiihrdlkpsnlavnedcelkildfgltrwyrapeimlnwmhynq
    tvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsl
    tqmpkmnfanganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydq
    sfesrdllidewksltydevisfvppp