PDB entry 5tcj

View 5tcj on RCSB PDB site
Description: Crystal structure of tryptophan synthase from M. tuberculosis - aminoacrylate and BRD4592-bound form
Class: lyase
Keywords: PLP, heterotetramer, amino acid biosynthesis, substrate channeling, allostery, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, LYASE
Deposited on 2016-09-15, released 2017-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tcja_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tcjc_
  • Chain 'D':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tcje_
  • Chain 'F':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: tryptophan synthase alpha chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpA, Rv1613, MTCY01B2.05
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5tcjg_
  • Chain 'H':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: trpB, Rv1612, MTCY01B2.04
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MLI, FMT, P1T, CS, 79V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tcjA (A:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpgmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tcjA (A:)
    easrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgm
    dgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaa
    gglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqa
    apelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltg
    elaagvrlg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tcjC (C:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpgmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tcjC (C:)
    easrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgm
    dgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaa
    gglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqa
    apelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltg
    elaagvrl
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5tcjE (E:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpgmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tcjE (E:)
    asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgmd
    gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
    glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqaa
    pelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltge
    laagvr
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5tcjG (G:)
    mvaveqseasrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgv
    pysdpgmdgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdaf
    ardlaaagglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfv
    yaastmgvtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgs
    alvtalteglprlraltgelaagvrlgmsahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tcjG (G:)
    asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgmd
    gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
    glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqaa
    pelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltge
    laagvrlg
    

  • Chain 'H':
    No sequence available.