PDB entry 5tc4

View 5tc4 on RCSB PDB site
Description: Crystal structure of human mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase (MTHFD2) in complex with LY345899 and cofactors
Class: oxidoreductase
Keywords: Inhibitor, Folate, Cofactor, Dehydrogenase, Oxidoreductase
Deposited on 2016-09-14, released 2016-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MTHFD2, NMDMC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tc4a1, d5tc4a2
  • Heterogens: NAD, L34, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tc4A (A:)
    meavvisgrklaqqikqevrqeveewvasgnkrphlsvilvgenpashsyvlnktraaav
    vginsetimkpasiseeellnlinklnnddnvdgllvqlplpehiderricnavspdkdv
    dgfhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllh
    tdgaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidv
    ginrvhdpvtakpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvlrl
    eerevlkskelgvatn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tc4A (A:)
    eavvisgrklaqqikqevrqeveewvasgnkrphlsvilvgenpashsyvlnktraaavv
    ginsetimkpasiseeellnlinklnnddnvdgllvqlplpehiderricnavspdkdvd
    gfhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllht
    dgaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidvg
    inrvhkpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvl